CACNG3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CACNG3 Antibody [NBP3-17047] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: CACNG3 Antibody [NBP3-17047] - Analysis in human cerebral cortex and pancreas tissues using Anti-CACNG3 antibody. Corresponding CACNG3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CACNG3 Antibody [NBP3-17047] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CACNG3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRS
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNG3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CACNG3 Antibody - BSA Free

• calcium channel, voltage-dependent, gamma subunit 3
• Neuronal voltage-gated calcium channel gamma-3 subunit
• voltage-dependent calcium channel gamma-3 subunit
• voltage-gated calcium channel gamma subunit

Background

L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This protein is similar to the mouse stargazin protein, mutations in which have been associated with absence seizures, also known as petit-mal or spike-wave seizures. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family. This gene is a candidate gene for a familial infantile convulsive disorder with paroxysomal choreoathetosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNG3