CACNG3 Antibody

Images

 
Immunohistochemistry-Paraffin: CACNG3 Antibody [NBP2-31738] - Staining of human lung shows strong cytoplasmic positivity in macrophages and endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CACNG3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CACNG3 Protein (NBP2-31738PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CACNG3 Antibody

  • calcium channel, voltage-dependent, gamma subunit 3
  • Neuronal voltage-gated calcium channel gamma-3 subunit
  • voltage-dependent calcium channel gamma-3 subunit
  • voltage-gated calcium channel gamma subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NBP2-14432
Species: Hu
Applications: IHC, IHC-P
NBP2-55863
Species: Hu
Applications: ICC/IF
H00000786-B01P
Species: Hu
Applications: WB, Flow
NBP1-86228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AB-230-NA
Species: Hu
Applications: WB, Neut
NB300-195
Species: Mu, Rt
Applications: WB, IHC
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-07010
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-31738
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CACNG3 Antibody (NBP2-31738) (0)

There are no publications for CACNG3 Antibody (NBP2-31738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNG3 Antibody (NBP2-31738) (0)

There are no reviews for CACNG3 Antibody (NBP2-31738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CACNG3 Antibody (NBP2-31738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNG3 Products

Bioinformatics Tool for CACNG3 Antibody (NBP2-31738)

Discover related pathways, diseases and genes to CACNG3 Antibody (NBP2-31738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNG3 Antibody (NBP2-31738)

Discover more about diseases related to CACNG3 Antibody (NBP2-31738).
 

Pathways for CACNG3 Antibody (NBP2-31738)

View related products by pathway.

Blogs on CACNG3

There are no specific blogs for CACNG3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNG3
Uniprot