We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CACNA1I Recombinant Protein Antigen

Images

 
There are currently no images for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CACNA1I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1I

Source: E.coli

Amino Acid Sequence: HHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1I
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25321It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CACNA1I Recombinant Protein Antigen

  • Ca(v)3.3
  • CACNA1I
  • calcium channel, voltage-dependent, T type, alpha 1I subunit
  • KIAA1120
  • voltage-dependent T-type calcium channel subunit alpha-1I
  • voltage-dependent, alpha 1I subunit
  • Voltage-gated calcium channel subunit alpha Cav3.3

Background

Function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Isoform alpha-1I gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H.; Subcellular location: Membrane; Multi-pass membrane protein.; Tissue specificity: Brain specific

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-22444
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, WB
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-17155
Species: Hu
Applications: IHC,  IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBC1-22925
Species: Hu
Applications: EnzAct, PAGE
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-87547
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB8286
Species: Hu
Applications: IHC
MAB6210
Species: Hu
Applications: Simple Western, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF7895
Species: Hu
Applications: IHC, WB
NBP3-47733
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP3-25321PEP
Species: Hu
Applications: AC

Publications for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP) (0)

There are no publications for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP) (0)

There are no reviews for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNA1I Products

Array NBP3-25321PEP

Research Areas for CACNA1I Recombinant Protein Antigen (NBP3-25321PEP)

Find related products by research area.

Blogs on CACNA1I

There are no specific blogs for CACNA1I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CACNA1I Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1I