Recombinant Human CACNA1I Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CACNA1I Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 233-331 of Human CACNA1I partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CACNA1I

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CACNA1I Protein

  • Ca(v)3.3
  • calcium channel, voltage-dependent, T type, alpha 1I subunit
  • voltage-dependent T-type calcium channel subunit alpha-1I
  • voltage-dependent, alpha 1I subunit
  • Voltage-gated calcium channel subunit alpha Cav3.3

Background

CACNA1I - calcium channel, voltage-dependent, alpha 1I subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-22444
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-58978
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Sh
Applications: ELISA, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB110-60019
Species: Mu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF7895
Species: Hu
Applications: WB, IHC
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for CACNA1I Partial Recombinant Protein (H00008911-Q01) (0)

There are no publications for CACNA1I Partial Recombinant Protein (H00008911-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA1I Partial Recombinant Protein (H00008911-Q01) (0)

There are no reviews for CACNA1I Partial Recombinant Protein (H00008911-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNA1I Partial Recombinant Protein (H00008911-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNA1I Products

Bioinformatics Tool for CACNA1I Partial Recombinant Protein (H00008911-Q01)

Discover related pathways, diseases and genes to CACNA1I Partial Recombinant Protein (H00008911-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA1I Partial Recombinant Protein (H00008911-Q01)

Discover more about diseases related to CACNA1I Partial Recombinant Protein (H00008911-Q01).
 

Pathways for CACNA1I Partial Recombinant Protein (H00008911-Q01)

View related products by pathway.

PTMs for CACNA1I Partial Recombinant Protein (H00008911-Q01)

Learn more about PTMs related to CACNA1I Partial Recombinant Protein (H00008911-Q01).

Blogs on CACNA1I

There are no specific blogs for CACNA1I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CACNA1I Antibody
NBP1-30674

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CACNA1I Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1I