![Immunocytochemistry/Immunofluorescence: C9orf9 Antibody [NBP1-90933] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://images.novusbio.com/fullsize/C9orf9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90933-img0008.jpg "Immunocytochemistry/Immunofluorescence: C9orf9 Antibody [NBP1-90933] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit C9orf9 Antibody - BSA Free (NBP1-90933) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFE |
| Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPACA9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPACA9 |
![Immunohistochemistry-Paraffin: C9orf9 Antibody [NBP1-90933] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/C9orf9-Antibody-Immunohistochemistry-Paraffin-NBP1-90933-img0009.jpg "Immunohistochemistry-Paraffin: C9orf9 Antibody [NBP1-90933] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: C9orf9 Antibody [NBP1-90933] - Staining of human testis shows strong positivity in flagella.](http://images.novusbio.com/fullsize/C9orf9-Antibody-Immunohistochemistry-Paraffin-NBP1-90933-img0007.jpg "Immunohistochemistry-Paraffin: C9orf9 Antibody [NBP1-90933] - Staining of human testis shows strong positivity in flagella.")
![Immunohistochemistry-Paraffin: C9orf9 Antibody [NBP1-90933] - Staining in human testis and endometrium tissues using anti-SPACA9 antibody. Corresponding SPACA9 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/C9orf9-Antibody-Immunohistochemistry-Paraffin-NBP1-90933-img0010.jpg "Immunohistochemistry-Paraffin: C9orf9 Antibody [NBP1-90933] - Staining in human testis and endometrium tissues using anti-SPACA9 antibody. Corresponding SPACA9 RNA-seq data are presented for the same tissues.")
![Immunocytochemistry LRIG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/LRIG1_AF3688_Immunocytochemistry_11198.jpg)
![Western Blot LRIG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/LRIG1_AF3688_Western_Blot_12828.jpg)
![Flow Cytometry LRIG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/LRIG1_AF3688_Flow_Cytometry_8208.jpg)
![Bioactivity Activin B/Inhibin beta B [Unconjugated]](https://images.novusbio.com/images2/Activin_B_8260AB_1020.jpg)
![SDS-PAGE Activin B/Inhibin beta B [Unconjugated]](https://images.novusbio.com/images2/Activin_B_8260AB_1347.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![HIN-1/SCGB3A1 Antibody (410219) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "HIN-1/SCGB3A1 Antibody (410219) [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")