C2GNT3 Antibody - BSA Free

Western Blot: C2GNT3 Antibody [NBP1-69591] - This Anti-GCNT4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

C2GNT3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GCNT4(glucosaminyl (N-acetyl) transferase 4, core 2 ) The peptide sequence was selected from the C terminal of GCNT4. Peptide sequence SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCNT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for C2GNT3 Antibody - BSA Free

• beta-1,3-galactosyl-O-glycosyl-glycoproteinbeta-1,6-N-acetylglucosaminyltransferase 4
• C2GNT3
• core 2 beta-1,6-N-acetylglucosaminyltransferase 3
• Core 2-branching enzyme 3
• Core2-GlcNAc-transferase 3
• EC 2.4.1.102
• GCNT4
• glucosaminyl (N-acetyl) transferase 4, core 2
• glucosaminyl (N-acetyl) transferase 4, core 2(beta-1,6-N-acetylglucosaminyltransferase)
• Gm279
• Gm73

Background

GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCNT4
• Uniprot:
  • Q9P109(Human)