C2GNT3 Antibody

Images

 
Western Blot: C2GNT3 Antibody [NBP1-69591] - This Anti-GCNT4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C2GNT3 Antibody Summary

Immunogen
Synthetic peptides corresponding to GCNT4(glucosaminyl (N-acetyl) transferase 4, core 2 ) The peptide sequence was selected from the C terminal of GCNT4. Peptide sequence SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCNT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GCNT4 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for C2GNT3 Antibody

  • beta-1,3-galactosyl-O-glycosyl-glycoproteinbeta-1,6-N-acetylglucosaminyltransferase 4
  • C2GNT3
  • core 2 beta-1,6-N-acetylglucosaminyltransferase 3
  • Core 2-branching enzyme 3
  • Core2-GlcNAc-transferase 3
  • EC 2.4.1.102
  • GCNT4
  • glucosaminyl (N-acetyl) transferase 4, core 2
  • glucosaminyl (N-acetyl) transferase 4, core 2(beta-1,6-N-acetylglucosaminyltransferase)
  • Gm279
  • Gm73

Background

GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7248
Species: Hu
Applications: WB, ICC
NBP1-88313
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
H00200958-P01
Species: Hu
AF8555
Species: Hu
Applications: WB
NBP1-52926
Species: Hu
Applications: WB
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P

Publications for C2GNT3 Antibody (NBP1-69591) (0)

There are no publications for C2GNT3 Antibody (NBP1-69591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2GNT3 Antibody (NBP1-69591) (0)

There are no reviews for C2GNT3 Antibody (NBP1-69591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C2GNT3 Antibody (NBP1-69591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C2GNT3 Products

Bioinformatics Tool for C2GNT3 Antibody (NBP1-69591)

Discover related pathways, diseases and genes to C2GNT3 Antibody (NBP1-69591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C2GNT3 Antibody (NBP1-69591)

Discover more about diseases related to C2GNT3 Antibody (NBP1-69591).
 

Pathways for C2GNT3 Antibody (NBP1-69591)

View related products by pathway.

Blogs on C2GNT3

There are no specific blogs for C2GNT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C2GNT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCNT4
Entrez
Uniprot