C1qTNF5/CTRP5 Recombinant Protein Antigen

Images

 
There are currently no images for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

C1qTNF5/CTRP5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C1qTNF5/CTRP5.

Source: E. coli

Amino Acid Sequence: ECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C1QTNF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34052.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for C1qTNF5/CTRP5 Recombinant Protein Antigen

  • C1q and tumor necrosis factor related protein 5
  • C1qTNF5
  • Complement C1q Tumor Necrosis Factor-Related Protein 5 Precursor Variant 3
  • CTRP5
  • CTRP5LORDDKFZp586B0621
  • LORD 6
  • Myonectin 3

Background

Defects in C1QTNF5 are a cause of late-onset retinal degeneration (LORD). LORD is an autosomal dominant disorder characterized by onset in the fifth to sixth decade with night blindness and punctate yellow-white deposits in the retinal fundus, progressing to severe central and peripheral degeneration, with choroidal neovascularization and chorioretinal atrophy.; Subcellular location: Secreted

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3445
Species: Mu
Applications: IHC, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
AF3145
Species: Hu
Applications: WB
DRP300
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP3-03895
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-76633
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DY1857
Species: Mu
Applications: ELISA
NBP2-34052PEP
Species: Hu
Applications: AC

Publications for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP) (0)

There are no publications for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP) (0)

There are no reviews for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C1qTNF5/CTRP5 Products

Research Areas for C1qTNF5/CTRP5 Recombinant Protein Antigen (NBP2-34052PEP)

Find related products by research area.

Blogs on C1qTNF5/CTRP5

There are no specific blogs for C1qTNF5/CTRP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our C1qTNF5/CTRP5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QTNF5