C1GALT1C1 Antibody - BSA Free

Western Blot: C1GALT1C1 Antibody [NBP2-84545] - Host: Rabbit. Target Name: C1galt1c1. Sample Type: Rat pancreas lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

C1GALT1C1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat C1GALT1C1. Peptide sequence: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1GALT1C1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for C1GALT1C1 Antibody - BSA Free

• beta 1,3-galactosyltransferase 2
• C1GalT1C1
• C1GALT1-specific chaperone 1
• C1GalT2
• C1Gal-T2
• C1GALT2MGC19947
• C38H2-L1
• Core 1 beta1,3-galactosyltransferase 2
• Core 1 beta3-galactosyltransferase-specific molecular chaperone
• Core 1 beta3-Gal-T2
• COSMC
• COSMCC38H2-like protein 1
• MST143
• TNPS

Background

The C1GALT1C1 gene encodes a type II transmembrane protein that is similar to the core 1 beta1,3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lack

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1GALT1C1