c-Myc-responsive protein Rcl Antibody - BSA Free

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP2-84700] - Host: Rabbit. Target Name: DNPH1. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

c-Myc-responsive protein Rcl Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human c-Myc-responsive protein Rcl. Peptide sequence: GRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for c-Myc-responsive protein Rcl Antibody - BSA Free

• chromosome 6 open reading frame 108
• c-Myc-responsive protein Rcl
• deoxyribonucleoside 5'-monophosphate N-glycosidase
• dJ330M21.3
• EC 3.2.2
• EC 3.2.2.-
• putative c-Myc-responsive
• rcl
• RP3-330M21.3

Background

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNPH1