Recombinant Human c-Fos GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human c-Fos Protein [H00002353-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related c-Fos Peptides and Proteins

Order Details


    • Catalog Number
      H00002353-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human c-Fos GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human c-Fos

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FOS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human c-Fos GST (N-Term) Protein

  • activator protein 1
  • AP-1
  • cellular oncogene c-fos
  • Cellular oncogene fos
  • cFos
  • c-Fos
  • FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS)
  • FBJ murine osteosarcoma viral oncogene homolog
  • Fos proto-oncogene, AP-1 trancription factor subunit
  • FOS
  • G0/G1 switch regulatory protein 7
  • G0S7
  • p55
  • proto-oncogene c-Fos

Background

c-Fos is an intermediate early gene that is one of four members of the FOS family of activator protein-1 (AP-1) transcription factors, which also includes Fra-1, Fra-2, and FosB (1-3). Under the FOS gene, human c-Fos is synthesized as a protein of 308 amino acids (aa) with a basic leucine zipper (bZip) domain important for dimerization, and a basic domain for interacting with DNA, with a theoretical molecular weight of ~40.6 kDa (4,5). c-Fos can heterodimerize with members of the JUN family (c-Jun, JunB, and JunD) to form the active transcription factor AP-1 complex (3,5). AP-1 related proteins bind TPA-related responsive elements (TRE), cAMP responsive elements (CRE), and related sequences, with c-Fos:c-Jun dimers partial to TRE sites (5).

In response to stimuli, c-Fos, which is encoded by protooncogenes, has a role in cell proliferation, differentiation, and transformation (3,6). A variety of stimuli can increase c-Fos expression such as growth factors, proinflammatory cytokines, UV radiation, neurotransmitters, hormones, injury, and stress (1,6). c-Fos has long been used as a marker for neuronal activity and is associated with neural and behavioral responses following stimuli (1-3, 6-7). Mouse studies have revealed that c-Fos is important for efficient neurogenesis and cortical development (3). Additionally, c-Fos signal can be used as a molecular marker for learning and memory, such as recognition and fear (2,7). Studies have found that repeated positive stimuli result in increased Fos expression while, conversely, repeated negative value stimuli are indicated by decreased signal (7). Intermediate early genes have also been implicated in neuropsychiatric disorders including showing altered c-Fos expression in a schizophrenia animal model (2). Furthermore, antipsychotics and antidepressants are both capable of impacting c-Fos expression (2).

References

1. Kovacs K. J. (1998). c-Fos as a transcription factor: a stressful (re)view from a functional map. Neurochemistry International. https://doi.org/10.1016/s0197-0186(98)00023-0

2. Gallo, F. T., Katche, C., Morici, J. F., Medina, J. H., & Weisstaub, N. V. (2018). Immediate Early Genes, Memory and Psychiatric Disorders: Focus on c-Fos, Egr1 and Arc. Frontiers in Behavioral Neuroscience. https://doi.org/10.3389/fnbeh.2018.00079

3. Velazquez, F. N., Caputto, B. L., & Boussin, F. D. (2015). c-Fos importance for brain development. Aging. https://doi.org/10.18632/aging.100862

4. Uniprot (P01100)

5. Wu, Z., Nicoll, M., & Ingham, R. J. (2021). AP-1 family transcription factors: a diverse family of proteins that regulate varied cellular activities in classical hodgkin lymphoma and ALK+ ALCL. Experimental Hematology & Oncology. https://doi.org/10.1186/s40164-020-00197-9

6. Shaulian, E., & Karin, M. (2001). AP-1 in cell proliferation and survival. Oncogene. https://doi.org/10.1038/sj.onc.1204383

7. Chung L. (2015). A Brief Introduction to the Transduction of Neural Activity into Fos Signal. Development & Reproduction. https://doi.org/10.12717/DR.2015.19.2.061

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
202-IL
Species: Hu
Applications: BA
AF2818
Species: Hu
Applications: ICC, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
AF4935
Species: Hu
Applications: IHC, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00002353-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for c-Fos Partial Recombinant Protein (H00002353-Q01) (0)

There are no publications for c-Fos Partial Recombinant Protein (H00002353-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for c-Fos Partial Recombinant Protein (H00002353-Q01) (0)

There are no reviews for c-Fos Partial Recombinant Protein (H00002353-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for c-Fos Partial Recombinant Protein (H00002353-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for some c-fos antibodies that could work in IHC.
    • Here are a list of products which might be of interest to you: Product List. We have additional filters on the left which may help you narrow down based on host species, target species, clonality, etc. We will guarantee these to work for all stated species and applications listed on the datasheet.

Additional c-Fos Products

Research Areas for c-Fos Partial Recombinant Protein (H00002353-Q01)

Find related products by research area.

Blogs on c-Fos.

The C99 fragment of amyloid precursor protein (APP)
Alzheimer’s Disease (AD) is a neurodegenerative disorder that is characterized by an abundance of the beta-amyloid peptide in the brain.  When AD was first discovered, it was determined that beta-amyloid was produced as a result of the prote...  Read full blog post.

Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration
By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human c-Fos GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOS