Recombinant Human c-Fos Protein

Images

 
SDS-Page: Recombinant Human c-Fos Protein [H00002353-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human c-Fos Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FOS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA

Protein/Peptide Type
Partial Recombinant Protein
Gene
FOS

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human c-Fos Protein

  • activator protein 1
  • AP-1
  • cellular oncogene c-fos
  • Cellular oncogene fos
  • cFos
  • c-Fos
  • FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS)
  • FBJ murine osteosarcoma viral oncogene homolog
  • FOS
  • G0/G1 switch regulatory protein 7
  • G0S7
  • proto-oncogene c-Fos
  • v-fos FBJ murine osteosarcoma viral oncogene homolog

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47757
Species: Hu
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002353-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for c-Fos Partial Recombinant Protein (H00002353-Q01) (0)

There are no publications for c-Fos Partial Recombinant Protein (H00002353-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for c-Fos Partial Recombinant Protein (H00002353-Q01) (0)

There are no reviews for c-Fos Partial Recombinant Protein (H00002353-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for c-Fos Partial Recombinant Protein (H00002353-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for some c-fos antibodies that could work in IHC.
    • Here are a list of products which might be of interest to you: Product List. We have additional filters on the left which may help you narrow down based on host species, target species, clonality, etc. We will guarantee these to work for all stated species and applications listed on the datasheet.

Additional c-Fos Products

Bioinformatics Tool for c-Fos Partial Recombinant Protein (H00002353-Q01)

Discover related pathways, diseases and genes to c-Fos Partial Recombinant Protein (H00002353-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for c-Fos Partial Recombinant Protein (H00002353-Q01)

Discover more about diseases related to c-Fos Partial Recombinant Protein (H00002353-Q01).
 

Pathways for c-Fos Partial Recombinant Protein (H00002353-Q01)

View related products by pathway.

PTMs for c-Fos Partial Recombinant Protein (H00002353-Q01)

Learn more about PTMs related to c-Fos Partial Recombinant Protein (H00002353-Q01).
 

Research Areas for c-Fos Partial Recombinant Protein (H00002353-Q01)

Find related products by research area.

Blogs on c-Fos.

The C99 fragment of amyloid precursor protein (APP)
Alzheimer’s Disease (AD) is a neurodegenerative disorder that is characterized by an abundance of the beta-amyloid peptide in the brain.  When AD was first discovered, it was determined that beta-amyloid was produced as a result of the prote...  Read full blog post.

Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration
By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human c-Fos Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOS
Entrez