Recombinant Human BVES Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BVES Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 262-360 of Human BVES partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP

Protein/Peptide Type
Partial Recombinant Protein
Gene
BVES

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BVES Protein

  • blood vessel epicardial substance
  • BVES
  • H
  • HBVES
  • POP1
  • POP1MGC42413
  • POPDC1
  • POPDC1popeye domain containing 1
  • Popeye domain-containing protein 1
  • Popeye protein 1

Background

BVES - blood vessel epicardial substance

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59476
Species: Hu
Applications: WB
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC

Publications for BVES Partial Recombinant Protein (H00011149-Q01) (0)

There are no publications for BVES Partial Recombinant Protein (H00011149-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BVES Partial Recombinant Protein (H00011149-Q01) (0)

There are no reviews for BVES Partial Recombinant Protein (H00011149-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BVES Partial Recombinant Protein (H00011149-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BVES Products

Bioinformatics Tool for BVES Partial Recombinant Protein (H00011149-Q01)

Discover related pathways, diseases and genes to BVES Partial Recombinant Protein (H00011149-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BVES Partial Recombinant Protein (H00011149-Q01)

Discover more about diseases related to BVES Partial Recombinant Protein (H00011149-Q01).
 

Pathways for BVES Partial Recombinant Protein (H00011149-Q01)

View related products by pathway.

PTMs for BVES Partial Recombinant Protein (H00011149-Q01)

Learn more about PTMs related to BVES Partial Recombinant Protein (H00011149-Q01).

Blogs on BVES

There are no specific blogs for BVES, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BVES Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BVES
Entrez