BTBD9 Antibody (3H3)

Images

 
Western Blot: BTBD9 Antibody (3H3) [H00114781-M01] - Analysis of BTBD9 expression in transfected 293T cell line by BTBD9 monoclonal antibody (M01), clone 3H3.Lane 1: BTBD9 transfected lysate(65.7 KDa).Lane 2: ...read more
Sandwich ELISA: BTBD9 Antibody (3H3) [H00114781-M01] - Detection limit for recombinant GST tagged BTBD9 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BTBD9 Antibody (3H3) Summary

Immunogen
BTBD9 (NP_689946, 2 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
Specificity
BTBD9 - BTB (POZ) domain containing 9
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BTBD9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BTBD9 Antibody (3H3)

  • BTB (POZ) domain containing 9
  • BTB/POZ domain-containing protein 9
  • FLJ32945
  • KIAA1880dJ322I12.1
  • MGC120517
  • MGC120519
  • MGC120520

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67763
Species: Hu
Applications: ICC/IF, WB
NBP2-24597
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-49153
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
H00023648-M01
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-83531
Species: Mu
Applications: WB
NBP1-59576
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
8184-CK
Species: Hu
Applications: EnzAct
AF619
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NB100-1798
Species: Hu, Mu
Applications: GS, ICC/IF, IHC, IHC-P, WB
NBP2-27084
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB110-60491
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
H00114781-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for BTBD9 Antibody (H00114781-M01) (0)

There are no publications for BTBD9 Antibody (H00114781-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD9 Antibody (H00114781-M01) (0)

There are no reviews for BTBD9 Antibody (H00114781-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTBD9 Antibody (H00114781-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTBD9 Products

Bioinformatics Tool for BTBD9 Antibody (H00114781-M01)

Discover related pathways, diseases and genes to BTBD9 Antibody (H00114781-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD9 Antibody (H00114781-M01)

Discover more about diseases related to BTBD9 Antibody (H00114781-M01).
 

Pathways for BTBD9 Antibody (H00114781-M01)

View related products by pathway.

Blogs on BTBD9

There are no specific blogs for BTBD9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD9 Antibody (3H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol BTBD9
Entrez
Uniprot