BTBD12 Recombinant Protein Antigen

Images

 
There are currently no images for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BTBD12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLX4.

Source: E.coli

Amino Acid Sequence: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLX4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58436. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BTBD12 Recombinant Protein Antigen

  • BTB (POZ) domain containing 12
  • BTB/POZ domain-containing protein 12
  • BTBD12structure-specific endonuclease subunit SLX4
  • KIAA1784MUS312
  • KIAA1987FANCP
  • SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2064
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
H00146956-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-42677
Species: Hu
Applications: WB, IHC-P, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58436PEP
Species: Hu
Applications: AC

Publications for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP) (0)

There are no publications for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP) (0)

There are no reviews for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP)

Discover related pathways, diseases and genes to BTBD12 Recombinant Protein Antigen (NBP2-58436PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP)

Discover more about diseases related to BTBD12 Recombinant Protein Antigen (NBP2-58436PEP).
 

Pathways for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP)

View related products by pathway.

PTMs for BTBD12 Recombinant Protein Antigen (NBP2-58436PEP)

Learn more about PTMs related to BTBD12 Recombinant Protein Antigen (NBP2-58436PEP).

Blogs on BTBD12

There are no specific blogs for BTBD12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
BTBD12 Antibody
NBP1-28680

Contact Information

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BTBD12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLX4