BST2 Antibody (0F5P3)

Western Blot: BST2 Antibody (0F5P3) [NBP3-16710] - Western blot analysis of extracts of various cell lines, using BST2 Rabbit mAb (NBP3-16710) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Mu, Rt
• Applications: WB
• Clone: 0F5P3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

BST2 Antibody (0F5P3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human BST2 (Q10589). LQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BST2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for BST2 Antibody (0F5P3)

• bone marrow stromal antigen 2
• bone marrow stromal cell antigen 2
• BST2
• BST-2
• CD317 antigen
• CD317
• HM1.24 Antigen
• NPC-A-7
• PDCA-1
• Tetherin

Background

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BST2