BRUNOL4 Antibody - BSA Free

Western Blot: BRUNOL4 Antibody [NBP1-57320] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BRUNOL4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CELF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BRUNOL4 Antibody - BSA Free

• Bruno (Drosophila) -like 4, RNA binding protein
• BRUNOL-4
• BRUNOL4Bruno -like 4, RNA binding protein
• bruno-like 4, RNA binding protein (Drosophila)
• bruno-like 4, RNA binding protein
• Bruno-like protein 4
• CELF-4
• CUG-BP and ETR-3 like factor 4
• CUG-BP- and ETR-3-like factor 4
• CUGBP Elav-like family member 4
• CUGBP, Elav-like family member 4
• LYST-interacting protein LIP9
• RNA-binding protein BRUNOL4
• RNA-binding protein BRUNOL-4

Background

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CELF4
• Entrez:
  • 56853(Human)
  • 108013(Mouse)
• Uniprot:
  • Q9BZC1(Human)