SCNM1 Antibody (1E10)

Images

 
Western Blot: SCNM1 Antibody (1E10) [H00079005-M01] - SCNM1 monoclonal antibody (M01), clone 1E10. Analysis of SCNM1 expression in human colon.
Sandwich ELISA: SCNM1 Antibody (1E10) [H00079005-M01] - Detection limit for recombinant GST tagged SCNM1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SCNM1 Antibody (1E10) Summary

Immunogen
SCNM1 (AAH00264, 1 a.a. ~ 231 a.a) full length recombinant protein with GST tag.MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRF ACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKE RKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNS CCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGP QAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWV KDENVEFDSDEEEPPDLPLD
Localization
Nuclear
Specificity
SCNM1 - sodium channel modifier 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCNM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCNM1 Antibody (1E10)

  • MGC3180
  • sodium channel modifier 1

Background

SCNM1 (Sodium channel modifier 1) contains a matrin-type zinc finger. It is thought to function as an RNA splicing factor. It is a disease modifier gene, that modifies phenotypic expression of SCN8A mutations in mice and is required for efficient in vivo splicing of a mutant splice donor site in the sodium channel SCN8A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006334-Q01
Species: Hu
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-84185
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89932
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006326-Q01
Species: Hu
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01446
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-92692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
NBP1-77227
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ICC, IF
8297-GG/CF
Species: Hu
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00079005-M01
Species: Hu
Applications: WB, ELISA

Publications for SCNM1 Antibody (H00079005-M01) (0)

There are no publications for SCNM1 Antibody (H00079005-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNM1 Antibody (H00079005-M01) (0)

There are no reviews for SCNM1 Antibody (H00079005-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCNM1 Antibody (H00079005-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SCNM1 Antibody (H00079005-M01)

Discover related pathways, diseases and genes to SCNM1 Antibody (H00079005-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCNM1 Antibody (H00079005-M01)

Discover more about diseases related to SCNM1 Antibody (H00079005-M01).
 

Pathways for SCNM1 Antibody (H00079005-M01)

View related products by pathway.

Blogs on SCNM1

There are no specific blogs for SCNM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCNM1 Antibody (1E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNM1
Entrez
OMIM
Uniprot