BRN3B/POU4F2 Antibody - BSA Free

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585] - Host: Rabbit. Target Name: POU4F2. Sample Tissue: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Western Blot: BRN3B/POU4F2 Antibody [NBP2-86585] - Host: Rabbit. Target Name: POU4F2. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BRN3B/POU4F2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human BRN3B/POU4F2. Peptide sequence: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU4F2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BRN3B/POU4F2 Antibody - BSA Free

• POU domain, class 4, transcription factor 2
• BRN3.2
• BRN3B
• Brn-3b
• POU class 4 homeobox 2

Background

POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU4F2