Breast carcinoma amplified sequence 3 Antibody

Images

 
Immunohistochemistry-Paraffin: Breast carcinoma amplified sequence 3 Antibody [NBP2-14348] Staining of human stomach, upper shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Breast carcinoma amplified sequence 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHM SSMEHTEEGLRERLADAMAESPSRDVVGSGTELQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCAS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Breast carcinoma amplified sequence 3 Antibody

  • BCAS4/BCAS3 fusion
  • breast carcinoma amplified sequence 3
  • breast carcinoma amplified sequence 4/3 fusion protein
  • breast carcinoma-amplified sequence 3
  • DKFZp686O1527
  • FLJ20128
  • GAOB1
  • MAAB
  • metastasis associated antigen of breast cancer
  • MGC4973
  • protein Maab1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77126
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-36991
Species: Hu
Applications: WB, PEP-ELISA
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31862
Species: Hu
Applications: IHC, IHC-P
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-16216
Species: Hu, Mu
Applications: WB

Publications for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348) (0)

There are no publications for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348) (0)

There are no reviews for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Breast carcinoma amplified sequence 3 Products

Bioinformatics Tool for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348)

Discover related pathways, diseases and genes to Breast carcinoma amplified sequence 3 Antibody (NBP2-14348). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348)

Discover more about diseases related to Breast carcinoma amplified sequence 3 Antibody (NBP2-14348).
 

Pathways for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348)

View related products by pathway.

PTMs for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348)

Learn more about PTMs related to Breast carcinoma amplified sequence 3 Antibody (NBP2-14348).
 

Research Areas for Breast carcinoma amplified sequence 3 Antibody (NBP2-14348)

Find related products by research area.

Blogs on Breast carcinoma amplified sequence 3

There are no specific blogs for Breast carcinoma amplified sequence 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Breast carcinoma amplified sequence 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAS3