BPNT1 Antibody - BSA Free

Western Blot: BPNT1 Antibody [NBP2-14359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: BPNT1 Antibody [NBP2-14359] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: BPNT1 Antibody [NBP2-14359] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BPNT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BPNT1 Antibody - BSA Free (NBP2-14359) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BPNT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BPNT1 Protein (NBP2-14359PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BPNT1 Antibody - BSA Free

• 3'(2'), 5'-bisphosphate nucleotidase 1,3'(2')5'-bisphosphate nucleotidase 1
• Bisphosphate 3'-nucleotidase 1
• BPntase
• EC 3.1.3
• EC 3.1.3.7
• PAP-inositol-1,4-phosphatase
• PIP

Background

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BPNT1