BPNT1 Antibody

Images

 
Western Blot: BPNT1 Antibody [NBP2-14359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: BPNT1 Antibody [NBP2-14359] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: BPNT1 Antibody [NBP2-14359] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BPNT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEG LLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BPNT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BPNT1 Protein (NBP2-14359PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BPNT1 Antibody

  • 3'(2'), 5'-bisphosphate nucleotidase 1,3'(2')5'-bisphosphate nucleotidase 1
  • Bisphosphate 3'-nucleotidase 1
  • BPntase
  • EC 3.1.3
  • EC 3.1.3.7
  • PAP-inositol-1,4-phosphatase
  • PIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42526
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA, S-ELISA, ELISA(Cap), ELISA(Det)
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5535
Species: Hu
Applications: WB, Simple Western
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF5117
Species: Hu
Applications: WB, IHC
NBP2-14359
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BPNT1 Antibody (NBP2-14359) (0)

There are no publications for BPNT1 Antibody (NBP2-14359).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPNT1 Antibody (NBP2-14359) (0)

There are no reviews for BPNT1 Antibody (NBP2-14359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BPNT1 Antibody (NBP2-14359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPNT1 Products

Bioinformatics Tool for BPNT1 Antibody (NBP2-14359)

Discover related pathways, diseases and genes to BPNT1 Antibody (NBP2-14359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPNT1 Antibody (NBP2-14359)

Discover more about diseases related to BPNT1 Antibody (NBP2-14359).
 

Pathways for BPNT1 Antibody (NBP2-14359)

View related products by pathway.

Research Areas for BPNT1 Antibody (NBP2-14359)

Find related products by research area.

Blogs on BPNT1

There are no specific blogs for BPNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPNT1