BMX Recombinant Protein Antigen

Images

 
There are currently no images for BMX Protein (NBP1-84778PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BMX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BMX.

Source: E.coli

Amino Acid Sequence: KFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BMX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84778.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BMX Recombinant Protein Antigen

  • BMX non-receptor tyrosine kinase
  • BMX
  • Bone marrow tyrosine kinase gene in chromosome X protein
  • EC 2.7.10
  • EC 2.7.10.2
  • Epithelial and endothelial tyrosine kinase
  • ETK
  • Etk/Bmx cytosolic tyrosine kinase
  • ETKcytoplasmic tyrosine-protein kinase BMX
  • NTK38 tyrosine kinase
  • NTK38
  • PSCTK2
  • PSCTK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-37000
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
7270-IL/CF
Species: Hu
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84778PEP
Species: Hu
Applications: AC

Publications for BMX Protein (NBP1-84778PEP) (0)

There are no publications for BMX Protein (NBP1-84778PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMX Protein (NBP1-84778PEP) (0)

There are no reviews for BMX Protein (NBP1-84778PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for BMX Protein (NBP1-84778PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BMX Protein (NBP1-84778PEP)

Discover related pathways, diseases and genes to BMX Protein (NBP1-84778PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMX Protein (NBP1-84778PEP)

Discover more about diseases related to BMX Protein (NBP1-84778PEP).
 

Pathways for BMX Protein (NBP1-84778PEP)

View related products by pathway.

PTMs for BMX Protein (NBP1-84778PEP)

Learn more about PTMs related to BMX Protein (NBP1-84778PEP).
 

Research Areas for BMX Protein (NBP1-84778PEP)

Find related products by research area.

Blogs on BMX

There are no specific blogs for BMX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMX Antibody
NBP1-84778
IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BMX Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BMX