BMPR-II Antibody

Images

 
Immunohistochemistry: BMPR-II Antibody [NBP1-88572] - Staining of human spleen shows distinct cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMPR-II Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BMPR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BMPR-II Protein (NBP1-88572PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BMPR-II Antibody

  • BMP type II receptor
  • BMP type-2 receptor
  • BMPR2
  • BMPR-2
  • BMPR3
  • BMPRII
  • BMPR-II
  • BMPR-IIprimary pulmonary hypertension 1
  • Bone morphogenetic protein receptor type II
  • bone morphogenetic protein receptor type-2
  • bone morphogenetic protein receptor, type II (serine/threonine kinase)
  • BRK-3
  • EC 2.7.11
  • EC 2.7.11.30
  • FLJ41585
  • FLJ76945
  • PPH1BMR2
  • T-ALK
  • type II activin receptor-like kinase
  • type II receptor for bone morphogenetic protein-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF853
Species: Mu
Applications: WB, IHC
AF3025
Species: Hu
Applications: WB, ICC
AF2250
Species: Hu
Applications: WB, IHC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-88572
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for BMPR-II Antibody (NBP1-88572) (0)

There are no publications for BMPR-II Antibody (NBP1-88572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMPR-II Antibody (NBP1-88572) (0)

There are no reviews for BMPR-II Antibody (NBP1-88572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BMPR-II Antibody (NBP1-88572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMPR-II Products

Bioinformatics Tool for BMPR-II Antibody (NBP1-88572)

Discover related pathways, diseases and genes to BMPR-II Antibody (NBP1-88572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMPR-II Antibody (NBP1-88572)

Discover more about diseases related to BMPR-II Antibody (NBP1-88572).
 

Pathways for BMPR-II Antibody (NBP1-88572)

View related products by pathway.

PTMs for BMPR-II Antibody (NBP1-88572)

Learn more about PTMs related to BMPR-II Antibody (NBP1-88572).
 

Research Areas for BMPR-II Antibody (NBP1-88572)

Find related products by research area.

Blogs on BMPR-II

There are no specific blogs for BMPR-II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMPR-II Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMPR2
Entrez