Recombinant Human BMPR-IA/ALK-3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BMPR-IA/ALK-3 Peptides and Proteins

Order Details


    • Catalog Number
      H00000657-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BMPR-IA/ALK-3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human BMPR1A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDS

Protein/Peptide Type
Partial Recombinant Protein
Gene
BMPR1A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BMPR-IA/ALK-3 Protein

  • ACVRLK310q23del
  • ALK-3
  • ALK3EC 2.7.11.30
  • BMP type-1A receptor
  • BMPR1A
  • BMPR-1A
  • BMPRIA
  • BMPR-IA
  • bone morphogenetic protein receptor type-1A
  • bone morphogenetic protein receptor, type IA
  • CD292 antigen
  • CD292
  • EC 2.7.11
  • Serine/threonine-protein kinase receptor R5
  • SKR5
  • type II-like kinase 3

Background

BMPR1A - bone morphogenetic protein receptor, type IA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF2097
Species: Hu
Applications: WB, ChIP, ICC
355-BM/CF
Species: Hu, Mu, Rt
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
AF3025
Species: Hu
Applications: WB, ICC
AF853
Species: Mu
Applications: WB, IHC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2250
Species: Hu
Applications: WB, IHC
H00000657-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01) (0)

There are no publications for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01) (0)

There are no reviews for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BMPR-IA/ALK-3 Products

Bioinformatics Tool for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01)

Discover related pathways, diseases and genes to BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01)

Discover more about diseases related to BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01).
 

Pathways for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01)

View related products by pathway.

PTMs for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01)

Learn more about PTMs related to BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01).
 

Research Areas for BMPR-IA/ALK-3 Partial Recombinant Protein (H00000657-Q01)

Find related products by research area.

Blogs on BMPR-IA/ALK-3

There are no specific blogs for BMPR-IA/ALK-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BMPR-IA/ALK-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BMPR1A
Entrez