Recombinant Human Blooms Syndrome Protein Blm Protein

Images

 
SDS-Page: Recombinant Human Blooms Syndrome Protein Blm Protein [H00000641-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Blooms Syndrome Protein Blm Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human BLM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BLM

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Blooms Syndrome Protein Blm Protein

  • Bloom syndrome
  • Bloom syndrome, RecQ helicase-like
  • BSBloom syndrome protein
  • DNA helicase, RecQ-like type 2
  • EC 3.6.1
  • EC 3.6.4.12
  • MGC126616
  • MGC131618
  • RecQ protein-like 3
  • RecQ2
  • RECQ2MGC131620
  • RECQL3RECQL2

Background

BLM - Bloom syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF4715
Species: Mu
Applications: WB
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
MAB4077
Species: Hu
Applications: WB, IHC
AF6108
Species: Hu
Applications: IHC
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00000641-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01) (0)

There are no publications for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01) (0)

There are no reviews for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Blooms Syndrome Protein Blm Products

Bioinformatics Tool for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01)

Discover related pathways, diseases and genes to Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01)

Discover more about diseases related to Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01).
 

Pathways for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01)

View related products by pathway.

PTMs for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01)

Learn more about PTMs related to Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01).
 

Research Areas for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01)

Find related products by research area.

Blogs on Blooms Syndrome Protein Blm

There are no specific blogs for Blooms Syndrome Protein Blm, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Blooms Syndrome Protein Blm Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BLM