Recombinant Human BLAP75 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BLAP75 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-470 of Human RMI1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAHSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILIERWSTMYRKGIHKFLMKMIVIYRVVL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RMI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
79.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BLAP75 GST (N-Term) Protein

  • 75 kDa
  • BLM-associated protein 75 kDa
  • BLM-associated protein of 75 kDa
  • chromosome 9 open reading frame 76
  • FAAP75
  • FLJ12888
  • homolog of yeast RecQ-mediated genome instability 1 (RMI1)
  • recQ-mediated genome instability protein 1
  • RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)
  • RMI2

Background

RMI1 is a component of protein complexes that limit DNA crossover formation via the dissolution of double Holliday junctions (Raynard et al., 2006 [PubMed 16595695]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89929
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-84308
Species: Hu
Applications: WB
NBP1-89962
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-471
Species: Hu
Applications: ChIP, ICC/IF, IHC, IP, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP3-04913
Species: Hu, Mu, Rt
Applications: WB
NB100-2064
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, WB
H00054821-D01P
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP3-12942
Species: Hu
Applications: WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87691
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-28680
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-30783
Species: Hu
Applications: ICC/IF, WB
H00080010-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BLAP75 Recombinant Protein (H00080010-P01) (0)

There are no publications for BLAP75 Recombinant Protein (H00080010-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLAP75 Recombinant Protein (H00080010-P01) (0)

There are no reviews for BLAP75 Recombinant Protein (H00080010-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BLAP75 Recombinant Protein (H00080010-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BLAP75 Products

Bioinformatics Tool for BLAP75 Recombinant Protein (H00080010-P01)

Discover related pathways, diseases and genes to BLAP75 Recombinant Protein (H00080010-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLAP75 Recombinant Protein (H00080010-P01)

Discover more about diseases related to BLAP75 Recombinant Protein (H00080010-P01).
 

Pathways for BLAP75 Recombinant Protein (H00080010-P01)

View related products by pathway.

PTMs for BLAP75 Recombinant Protein (H00080010-P01)

Learn more about PTMs related to BLAP75 Recombinant Protein (H00080010-P01).
 

Research Areas for BLAP75 Recombinant Protein (H00080010-P01)

Find related products by research area.

Blogs on BLAP75

There are no specific blogs for BLAP75, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WRN Antibody
NB100-471

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BLAP75 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RMI1