Recombinant Human BIRC8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BIRC8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 127 - 236 of Human BIRC8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BIRC8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BIRC8 Protein

  • baculoviral IAP repeat containing 8
  • baculoviral IAP repeat-containing 8
  • baculoviral IAP repeat-containing protein 8
  • hILP2
  • IAP-like protein 2
  • ILP-2ILP2
  • Inhibitor of apoptosis-like protein 2
  • Testis-specific inhibitor of apoptosis

Background

BIRC8 - baculoviral IAP repeat-containing 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56548
Species: Hu
Applications: WB, ICC/IF
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB829
Species: Hu
Applications: WB, IHC
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF8241
Species: Hu, Mu
Applications: IHC
NBP2-34122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NB100-77331
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00112401-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BIRC8 Partial Recombinant Protein (H00112401-Q01) (0)

There are no publications for BIRC8 Partial Recombinant Protein (H00112401-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIRC8 Partial Recombinant Protein (H00112401-Q01) (0)

There are no reviews for BIRC8 Partial Recombinant Protein (H00112401-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BIRC8 Partial Recombinant Protein (H00112401-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BIRC8 Products

Bioinformatics Tool for BIRC8 Partial Recombinant Protein (H00112401-Q01)

Discover related pathways, diseases and genes to BIRC8 Partial Recombinant Protein (H00112401-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIRC8 Partial Recombinant Protein (H00112401-Q01)

Discover more about diseases related to BIRC8 Partial Recombinant Protein (H00112401-Q01).
 

Pathways for BIRC8 Partial Recombinant Protein (H00112401-Q01)

View related products by pathway.

Research Areas for BIRC8 Partial Recombinant Protein (H00112401-Q01)

Find related products by research area.

Blogs on BIRC8

There are no specific blogs for BIRC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Caspase-9 Antibody
NB100-56118
BIRC8 Antibody
NBP1-76669

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BIRC8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BIRC8