BIRC8 Antibody - BSA Free

Western Blot: BIRC8 Antibody [NBP2-88774] - Host: Rabbit. Target Name: BIRC8. Sample Tissue: DLD1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BIRC8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BIRC8 Antibody - BSA Free (NBP2-88774) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BIRC8. Peptide sequence: WMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BIRC8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BIRC8 Antibody - BSA Free

• baculoviral IAP repeat containing 8
• baculoviral IAP repeat-containing 8
• baculoviral IAP repeat-containing protein 8
• BIRC8
• hILP2
• IAP-like protein 2
• ILP2
• ILP-2ILP2
• Inhibitor of apoptosis-like protein 2
• RNF136
• Testis-specific inhibitor of apoptosis

Background

Apoptosis, or programmed cell death, is related to many diseases, such as cancer. Apoptosis is triggered by a variety of stimuli including members in the TNF family and prevented by the inhibitor of apoptosis (IAP) proteins. IAP proteins form a conserved gene family including IAP, XIAP/ILP-1/MIHA, and Livin/KIAP that bind to and inhibits specific proteases. A novel member in the IAP protein family was recently identified and designated ILP-2 for IAP-like protein-2. ILP-2 has high homology to ILP-1, but is encoded by a distinct gene that is solely expressed in testis of tested normal human tissues. ILP-2, unlike ILP-1, has no inhibitory effect on Fas and TNF induced apoptosis, but potently inhibits apoptosis induced by overexpression of Bax or by coexpression of caspase-9 with Apaf-1. ILP-2 interacts with the processed caspase-9. These results suggest that ILP-2 is a novel IAP family member with restricted specificity for caspase-9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BIRC8