Biglycan Recombinant Protein Antigen

Images

 
There are currently no images for Biglycan Protein (NBP1-84971PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Biglycan Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BGN.

Source: E. coli

Amino Acid Sequence: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BGN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84971.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Biglycan Recombinant Protein Antigen

  • BGN
  • Biglycan
  • Bone/cartilage proteoglycan I
  • bone/cartilage proteoglycan-I
  • dermatan sulphate proteoglycan I
  • DSPG1
  • PGI
  • PG-S1
  • SLRR1A
  • SLRR1Abiglycan proteoglycan
  • small leucine-rich protein 1A

Background

Biglycan is encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-85432
Species: Hu, Mu
Applications: COMET, IHC,  IHC-P, mIF
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
DPG00
Species: Hu
Applications: ELISA
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-91011
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-31589
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7788
Species: Hu
Applications: Simple Western, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for Biglycan Protein (NBP1-84971PEP) (0)

There are no publications for Biglycan Protein (NBP1-84971PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biglycan Protein (NBP1-84971PEP) (0)

There are no reviews for Biglycan Protein (NBP1-84971PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Biglycan Protein (NBP1-84971PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Biglycan Products

Research Areas for Biglycan Protein (NBP1-84971PEP)

Find related products by research area.

Blogs on Biglycan

There are no specific blogs for Biglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Biglycan Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BGN