beta-2 Adrenergic R/ADRB2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit beta-2 Adrenergic R/ADRB2 Antibody - BSA Free (NBP1-90227) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADRB2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for beta-2 Adrenergic R/ADRB2 Antibody - BSA Free
Background
The beta-2 adrenoceptor (ADRB2) is an Adrenergic Receptor expressed in smooth muscle and metabolic tissues. Activation of this receptor induces a decrease in gastrointestinal motility, bronchodilation, vasodilation in skeletal and cardiac muscle, and glycogenolysis in liver. The beta-2 adrenoceptor is also a major lipolytic receptor in human fat cells and may be involved in obesity. Agonists of ADRB2 are most widely used for the treatment of asthma. In complex with beta-arrestin-1 and c-src, the beta-2 adrenergic receptor activates MAP kinases ERK1(MAPK3) and ERK2 (MAPK1). Expression of the beta-2 adrenoceptor has been reported in adipose, blood, brain, heart, lung, nose, pancreas, skeletal muscle, skin, and vessel. ESTs have been isolated from breast, liver, liver/spleen, placenta, and uterus libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, In vitro, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: IHC
Publications for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227) (0)
There are no publications for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227) (0)
There are no reviews for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional beta-2 Adrenergic R/ADRB2 Products
Research Areas for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227)
Find related products by research area.
|
Blogs on beta-2 Adrenergic R/ADRB2