beta-2 Adrenergic R/ADRB2 Antibody

Images

 
Immunohistochemistry: beta-2 Adrenergic R/ADRB2 Antibody [NBP1-90227] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta-2 Adrenergic R/ADRB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADRB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta-2 Adrenergic R/ADRB2 Antibody

  • ADRB2
  • ADRB2R
  • ADRBR
  • adrenergic, beta-2-, receptor, surface
  • B2AR
  • B2ARADRB2R
  • BAR
  • beta-2 Adrenergic R
  • beta-2 adrenergic receptor
  • beta2 AdrenergicR
  • beta-2 AdrenergicR
  • Beta-2 adrenoceptor
  • Beta-2 adrenoreceptor
  • BETA2AR
  • catecholamine receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59007
Species: Hu, Mu
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93369
Species: Hu
Applications: WB, PEP-ELISA
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP1-90227
Species: Hu
Applications: IHC, IHC-P

Publications for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227) (0)

There are no publications for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227) (0)

There are no reviews for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-2 Adrenergic R/ADRB2 Products

Bioinformatics Tool for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227)

Discover related pathways, diseases and genes to beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227)

Discover more about diseases related to beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227).
 

Pathways for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227)

View related products by pathway.

PTMs for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227)

Learn more about PTMs related to beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227).
 

Research Areas for beta-2 Adrenergic R/ADRB2 Antibody (NBP1-90227)

Find related products by research area.

Blogs on beta-2 Adrenergic R/ADRB2

There are no specific blogs for beta-2 Adrenergic R/ADRB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-2 Adrenergic R/ADRB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADRB2
Entrez