Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody [NBP2-30927] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & mitochondria.
Immunohistochemistry-Paraffin: Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody [NBP2-30927] - Staining of human skin shows cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Protein (NBP2-30927PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody

  • B3GNT4
  • B3GN-T4
  • beta-1,3-Gn-T4
  • Beta-1,3-N-acetylglucosaminyltransferase 4
  • beta-1,3-N-acetylglucosaminyltransferase bGn-T4
  • beta3Gn-T4
  • BGnT-4
  • EC 2.4.1.-
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007357-M03
Species: Hu
Applications: WB, ELISA
NBP2-45527
Species: Hu
Applications: WB, IHC, IF
NBP2-49661
Species: Hu
Applications: WB, IHC
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5968
Species: Hu
Applications: WB, IP
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88952
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32539
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
AF5768
Species: Hu
Applications: WB, Simple Western, IHC, IP
8907-GH
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-30927
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927) (0)

There are no publications for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927) (0)

There are no reviews for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Products

Bioinformatics Tool for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927)

Discover related pathways, diseases and genes to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927)

Discover more about diseases related to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927).
 

Pathways for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927)

View related products by pathway.

PTMs for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927)

Learn more about PTMs related to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody (NBP2-30927).

Blogs on Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4

There are no specific blogs for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT4
Entrez
Uniprot