BCL6B Recombinant Protein Antigen

Images

 
There are currently no images for BCL6B Recombinant Protein Antigen (NBP2-68997PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BCL6B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCL6B.

Source: E.coli

Amino Acid Sequence: YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCL6B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68997. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BCL6B Recombinant Protein Antigen

  • BAZFBcl6-associated zinc finger protein
  • B-cell CLL/lymphoma 6 member B protein
  • B-cell CLL/lymphoma 6, member B (zinc finger protein)
  • B-cell CLL/lymphoma 6, member B
  • ZBTB28
  • Zinc finger protein 62ZNF62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF482
Species: Mu
Applications: WB, IHC
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
6507-IL/CF
Species: Hu
NBP2-68997PEP
Species: Hu
Applications: AC

Publications for BCL6B Recombinant Protein Antigen (NBP2-68997PEP) (0)

There are no publications for BCL6B Recombinant Protein Antigen (NBP2-68997PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL6B Recombinant Protein Antigen (NBP2-68997PEP) (0)

There are no reviews for BCL6B Recombinant Protein Antigen (NBP2-68997PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BCL6B Recombinant Protein Antigen (NBP2-68997PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional BCL6B Products

Bioinformatics Tool for BCL6B Recombinant Protein Antigen (NBP2-68997PEP)

Discover related pathways, diseases and genes to BCL6B Recombinant Protein Antigen (NBP2-68997PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL6B Recombinant Protein Antigen (NBP2-68997PEP)

Discover more about diseases related to BCL6B Recombinant Protein Antigen (NBP2-68997PEP).
 

Pathways for BCL6B Recombinant Protein Antigen (NBP2-68997PEP)

View related products by pathway.

PTMs for BCL6B Recombinant Protein Antigen (NBP2-68997PEP)

Learn more about PTMs related to BCL6B Recombinant Protein Antigen (NBP2-68997PEP).

Blogs on BCL6B

There are no specific blogs for BCL6B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BCL6B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL6B
Novus 100% Guarantee