Recombinant Human BCL2L12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BCL2L12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human BCL2L12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BCL2L12
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BCL2L12 Protein

  • Bcl-2 related proline-rich protein
  • bcl2-L-12
  • BCL2-like 12 (proline rich)
  • bcl-2-like protein 12
  • Bcl-2-related proline-rich protein
  • BPR
  • MGC120313
  • MGC120314
  • MGC120315

Background

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF875
Species: Hu
Applications: WB, IHC
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for BCL2L12 Recombinant Protein (H00083596-P01) (0)

There are no publications for BCL2L12 Recombinant Protein (H00083596-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL2L12 Recombinant Protein (H00083596-P01) (0)

There are no reviews for BCL2L12 Recombinant Protein (H00083596-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL2L12 Recombinant Protein (H00083596-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCL2L12 Products

Bioinformatics Tool for BCL2L12 Recombinant Protein (H00083596-P01)

Discover related pathways, diseases and genes to BCL2L12 Recombinant Protein (H00083596-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL2L12 Recombinant Protein (H00083596-P01)

Discover more about diseases related to BCL2L12 Recombinant Protein (H00083596-P01).
 

Pathways for BCL2L12 Recombinant Protein (H00083596-P01)

View related products by pathway.

PTMs for BCL2L12 Recombinant Protein (H00083596-P01)

Learn more about PTMs related to BCL2L12 Recombinant Protein (H00083596-P01).
 

Research Areas for BCL2L12 Recombinant Protein (H00083596-P01)

Find related products by research area.

Blogs on BCL2L12

There are no specific blogs for BCL2L12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BCL2L12 Antibody
NBP1-86025

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BCL2L12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L12