Recombinant Human Bcl G Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Bcl G Protein Summary

Description
Bcl G (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BCL2L14

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Bcl G Protein

  • apoptosis facilitator Bcl-2-like protein 14
  • Apoptosis regulator Bcl-G
  • Bcl2-L-14
  • BCL2-like 14 (apoptosis facilitator)
  • BCL-G
  • BCLGbcl2-L-14

Background

BCL2L14( AAH25778, 1 a.a. - 328 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55090
Species: Hu
Applications: WB, IHC, IHC-P
AF4820
Species: Hu
Applications: WB, IHC
NBP2-24501
Species: Hu, Mu, Bv, Pm
Applications: WB, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-46578
Species: Hu
Applications: WB, IHC
NBP1-85884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Bcl G Recombinant Protein (H00079370-P01) (0)

There are no publications for Bcl G Recombinant Protein (H00079370-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl G Recombinant Protein (H00079370-P01) (0)

There are no reviews for Bcl G Recombinant Protein (H00079370-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bcl G Recombinant Protein (H00079370-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bcl G Products

Bioinformatics Tool for Bcl G Recombinant Protein (H00079370-P01)

Discover related pathways, diseases and genes to Bcl G Recombinant Protein (H00079370-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl G Recombinant Protein (H00079370-P01)

Discover more about diseases related to Bcl G Recombinant Protein (H00079370-P01).
 

Pathways for Bcl G Recombinant Protein (H00079370-P01)

View related products by pathway.

PTMs for Bcl G Recombinant Protein (H00079370-P01)

Learn more about PTMs related to Bcl G Recombinant Protein (H00079370-P01).
 

Research Areas for Bcl G Recombinant Protein (H00079370-P01)

Find related products by research area.

Blogs on Bcl G

There are no specific blogs for Bcl G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Bcl-2 Antibody
NB100-56098
Bcl-2 Antibody
NB100-56098
Bcl-2 Antibody
NB100-56098
Bcl G Antibody
NBP1-91697
Bcl G Antibody
NBP1-91697
Bcl G Antibody
NBP1-91697
BID Antibody
NB100-56106
BID Antibody
NB100-56106
BID Antibody
NB100-56106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Bcl G Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L14