Bcl-2 related protein A1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Bcl-2 related protein A1 Antibody - BSA Free (NBP3-10872) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human Bcl-2 related protein A1 (NP_004040). Peptide sequence FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BCL2A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Bcl-2 related protein A1 Antibody - BSA Free
Background
Bcl-2 related protein A1; also known as Bcl2A1 and Bfl1, is an anti-apoptotic Bcl-2 family member preferentially expressed in hematopoietic and endothelial cells (1). Bfl1 is involved in a variety of cellular activities such as embryonic development, homeostatis and tumorigenesis. Expression of Bfl1 is stimulated by NF-kB in response to inflammatory stimuli and is up-regulated by TNF-alpha, IL1-beta, IGF1, GMC-SF, CD40 and phorbol ester (2-3). Blf1 has also been shown to reduce the release of pro-apoptotic cytochrome c from the mitochondria, block caspase activation and suppress apoptosis induced by p53 (4-5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for Bcl-2 related protein A1 Antibody (NBP3-10872) (0)
There are no publications for Bcl-2 related protein A1 Antibody (NBP3-10872).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Bcl-2 related protein A1 Antibody (NBP3-10872) (0)
There are no reviews for Bcl-2 related protein A1 Antibody (NBP3-10872).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Bcl-2 related protein A1 Antibody (NBP3-10872) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Bcl-2 related protein A1 Products
Research Areas for Bcl-2 related protein A1 Antibody (NBP3-10872)
Find related products by research area.
|
Blogs on Bcl-2 related protein A1