BCAS1 Antibody (1B5) - Azide and BSA Free

Immunohistochemistry-Paraffin: BCAS1 Antibody (1B5) [H00008537-M03] - Analysis of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml

Sandwich ELISA: BCAS1 Antibody (1B5) [H00008537-M03] - Detection limit for recombinant GST tagged BCAS1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BCAS1 Antibody (1B5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: BCAS1 (NP_003648, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL
• Specificity: BCAS1 (1B5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BCAS1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCAS1 Antibody (1B5) - Azide and BSA Free

• breast carcinoma amplified sequence 1
• breast carcinoma-amplified sequence 1
• NABC1AIBC1Amplified and overexpressed in breast cancer
• Novel amplified in breast cancer 1

Background

This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAS1
• Entrez:
  • 8537(Human)
• OMIM:
  • 602968(Human)
• Uniprot:
  • NP_003648(Human)