BCAS1 Antibody (1B5)


Immunohistochemistry-Paraffin: BCAS1 Antibody (1B5) [H00008537-M03] - Analysis of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml
Sandwich ELISA: BCAS1 Antibody (1B5) [H00008537-M03] - Detection limit for recombinant GST tagged BCAS1 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P

Order Details

BCAS1 Antibody (1B5) Summary

BCAS1 (NP_003648, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL
BCAS1 (1B5)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCAS1 Antibody (1B5)

  • breast carcinoma amplified sequence 1
  • breast carcinoma-amplified sequence 1
  • NABC1AIBC1Amplified and overexpressed in breast cancer
  • Novel amplified in breast cancer 1


This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Mu
Applications: Flow, CyTOF-ready

Publications for BCAS1 Antibody (H00008537-M03) (0)

There are no publications for BCAS1 Antibody (H00008537-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAS1 Antibody (H00008537-M03) (0)

There are no reviews for BCAS1 Antibody (H00008537-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCAS1 Antibody (H00008537-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BCAS1 Products

Bioinformatics Tool for BCAS1 Antibody (H00008537-M03)

Discover related pathways, diseases and genes to BCAS1 Antibody (H00008537-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAS1 Antibody (H00008537-M03)

Discover more about diseases related to BCAS1 Antibody (H00008537-M03).

Pathways for BCAS1 Antibody (H00008537-M03)

View related products by pathway.

Research Areas for BCAS1 Antibody (H00008537-M03)

Find related products by research area.

Blogs on BCAS1

There are no specific blogs for BCAS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BCAS1 Antibody (1B5) and receive a gift card or discount.


Gene Symbol BCAS1