BCAS1 Antibody (1B5)

Images

 
Immunohistochemistry-Paraffin: BCAS1 Antibody (1B5) [H00008537-M03] - Analysis of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml
Sandwich ELISA: BCAS1 Antibody (1B5) [H00008537-M03] - Detection limit for recombinant GST tagged BCAS1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BCAS1 Antibody (1B5) Summary

Immunogen
BCAS1 (NP_003648, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL
Specificity
BCAS1 (1B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BCAS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCAS1 Antibody (1B5)

  • breast carcinoma amplified sequence 1
  • breast carcinoma-amplified sequence 1
  • NABC1AIBC1Amplified and overexpressed in breast cancer
  • Novel amplified in breast cancer 1

Background

This gene resides in a region at 20q13 which is amplified in a variety of tumor types and associated with more aggressive tumor phenotypes. Among the genes identified from this region, it was found to be highly expressed in three amplified breast cancer cell lines and in one breast tumor without amplification at 20q13.2. However, this gene is not in the common region of maximal amplification and its expression was not detected in the breast cancer cell line MCF7, in which this region is highly amplified. Although not consistently expressed, this gene is a candidate oncogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003249-P01
Species: Hu
Applications: WB
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4505
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP2-46424
Species: Hu
Applications: WB, IHC, IHC-P
H00009498-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-88514
Species: Hu
Applications: IHC, IHC-P
MAB3737
Species: Mu
Applications: Flow, CyTOF-ready
H00008537-M03
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for BCAS1 Antibody (H00008537-M03) (0)

There are no publications for BCAS1 Antibody (H00008537-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAS1 Antibody (H00008537-M03) (0)

There are no reviews for BCAS1 Antibody (H00008537-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCAS1 Antibody (H00008537-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCAS1 Products

Bioinformatics Tool for BCAS1 Antibody (H00008537-M03)

Discover related pathways, diseases and genes to BCAS1 Antibody (H00008537-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAS1 Antibody (H00008537-M03)

Discover more about diseases related to BCAS1 Antibody (H00008537-M03).
 

Pathways for BCAS1 Antibody (H00008537-M03)

View related products by pathway.

Research Areas for BCAS1 Antibody (H00008537-M03)

Find related products by research area.

Blogs on BCAS1

There are no specific blogs for BCAS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCAS1 Antibody (1B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAS1
Entrez
OMIM
Uniprot