Recombinant Human BCAR3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BCAR3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 266-373 of Human BCAR3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BCAR3

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BCAR3 Protein

  • breast cancer estrogen resistance 3
  • dJ1033H22.2 (breast cancer estrogen resistance 3)
  • KIAA0554
  • Novel SH2-containing protein 2
  • NSP2SH2D3Bbreast cancer estrogen resistance protein 3
  • SH2 domain-containing protein 3B

Background

BCAR3 - breast cancer anti-estrogen resistance 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82525
Species: Hu
Applications: WB, IHC, IHC-P
NB100-517
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF6990
Species: Mu
Applications: WB, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97677
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF

Publications for BCAR3 Partial Recombinant Protein (H00008412-Q01) (0)

There are no publications for BCAR3 Partial Recombinant Protein (H00008412-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAR3 Partial Recombinant Protein (H00008412-Q01) (0)

There are no reviews for BCAR3 Partial Recombinant Protein (H00008412-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCAR3 Partial Recombinant Protein (H00008412-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCAR3 Products

Bioinformatics Tool for BCAR3 Partial Recombinant Protein (H00008412-Q01)

Discover related pathways, diseases and genes to BCAR3 Partial Recombinant Protein (H00008412-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAR3 Partial Recombinant Protein (H00008412-Q01)

Discover more about diseases related to BCAR3 Partial Recombinant Protein (H00008412-Q01).
 

Pathways for BCAR3 Partial Recombinant Protein (H00008412-Q01)

View related products by pathway.

PTMs for BCAR3 Partial Recombinant Protein (H00008412-Q01)

Learn more about PTMs related to BCAR3 Partial Recombinant Protein (H00008412-Q01).
 

Research Areas for BCAR3 Partial Recombinant Protein (H00008412-Q01)

Find related products by research area.

Blogs on BCAR3

There are no specific blogs for BCAR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BCAR3 Antibody
NB100-87003

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BCAR3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAR3