BAT5 Antibody - BSA Free

Immunohistochemistry-Paraffin: BAT5 Antibody [NBP2-34116] - Staining of human colon shows distinct cytoplasmic positivity in endothelial cells.

Product Discontinued

BAT5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
• Predicted Species: Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABHD16A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BAT5 Antibody - BSA Free

• abhydrolase domain containing 16A
• BAT5G5
• D6S82EEC 3.-
• HLA-B associated transcript 5
• HLA-B-associated transcript 5
• NG26protein BAT5
• PP199
• Protein G5

Background

BAT5 - HLA-B associated transcript 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABHD16A
• Uniprot:
  • O95870(Human)