Bassoon Recombinant Protein Antigen

Product Discontinued

Bassoon Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BSN.

  Source: E. coli

  Amino Acid Sequence: AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BSN
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80595.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bassoon Recombinant Protein Antigen

• bassoon (presynaptic cytomatrix protein)

Background

Bassoon is a 420 kDa protein that is a localized at the presynaptic nerve terminals and is believed to play a role in the structural and functional organization of the synaptic vesicle cycle (1-3). Bassoon does not belong to any known protein families. It has been found in rat and mouse with sequence identity of the two proteins at 96% (1). The human BASSOON gene has recently been cloned and localized (3). Bassoon is predicted to contain two double-zinc fingers, three coiled-coil regions, and two polyglutamine domains (1). The polyglutamine domains in the C-terminus are of interest, since it is known that for some human proteins, such as Huntingtin, abnormal amplification of this region can cause late-onset neurodegeneration (1,3). Bassoon is concentrated at sites opposite to postsynaptic densities in synaptic terminals and in cultured neurons, it is found to colocalize with GABA (A) and glutamate (GluR1) receptors (2). Another presynaptic protein, Piccolo (4) was found to colocalize with Bassoon in cultured hippocampal neurons (1). These observations suggested that they serve specific functions at synaptic junctions and may be involved in organization of the cytoskeleton at the site of neurotransmitter release (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

FAQs for Bassoon Protein (NBP1-80595PEP). (Showing 1 - 1 of 1 FAQ).

1. I am looking for a good antibody to detect Bassoon in mouse brain slices (PFA fixed); can you recommend any one for this?
   • After searching through our product catalog list, we have found the following antibodies which may be of interest: Bassoo. Using the filters on the left column of the site should allow you to filter by species and desired application. Any antibody that is listed to show validation for use in IHC-P and has also been validated in mouse samples will be backed by our 100% Guarantee. Under the terms and conditions of the guarantee, Novus will provide you with a full refund or replacement should the antibody fail to perform, as specified, in samples expressing the protein.

Bioinformatics

• Gene Symbol: BSN