Bassoon Antibody

Immunohistochemistry-Paraffin: Bassoon Antibody [NBP1-80595] - Staining of human lateral ventricle shows distinct positivity in neuropil.

Product Discontinued

Bassoon Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BSN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Bassoon Antibody

• bassoon (presynaptic cytomatrix protein)

Background

Bassoon is a 420 kDa protein that is a localized at the presynaptic nerve terminals and is believed to play a role in the structural and functional organization of the synaptic vesicle cycle (1-3). Bassoon does not belong to any known protein families. It has been found in rat and mouse with sequence identity of the two proteins at 96% (1). The human BASSOON gene has recently been cloned and localized (3). Bassoon is predicted to contain two double-zinc fingers, three coiled-coil regions, and two polyglutamine domains (1). The polyglutamine domains in the C-terminus are of interest, since it is known that for some human proteins, such as Huntingtin, abnormal amplification of this region can cause late-onset neurodegeneration (1,3). Bassoon is concentrated at sites opposite to postsynaptic densities in synaptic terminals and in cultured neurons, it is found to colocalize with GABA (A) and glutamate (GluR1) receptors (2). Another presynaptic protein, Piccolo (4) was found to colocalize with Bassoon in cultured hippocampal neurons (1). These observations suggested that they serve specific functions at synaptic junctions and may be involved in organization of the cytoskeleton at the site of neurotransmitter release (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Bassoon Antibody (NBP1-80595)(3)

Publications using NBP1-80595

• Nishiyama T, Zhang Y, Cui M et al. Precise genomic editing of pathogenic mutations in RBM20 rescues dilated cardiomyopathy Science translational medicine 2022-11-23 [PMID: 36417486] (ICC/IF, Human)
• Kurosaki T, Mitsutomi S, Hewko A et al. Integrative omics indicate FMRP sequesters mRNA from translation and deadenylation in human neuronal cells Molecular cell 2022-11-01 [PMID: 36356584]
• Schattling, B;Engler, JB;Volkmann, C;Rothammer, N;Woo, MS;Petersen, M;Winkler, I;Kaufmann, M;Rosenkranz, SC;Fejtova, A;Thomas, U;Bose, A;Bauer, S;Trager, S;Miller, KK;Bruck, W;Duncan, KE;Salinas, G;Soba, P;Gundelfinger, ED;Merkler, D;Friese, MA; Bassoon proteinopathy drives neurodegeneration in multiple sclerosis Nat. Neurosci. 2019-04-22 [PMID: 31011226] (IHC-P, Human)

FAQs for Bassoon Antibody (NBP1-80595). (Showing 1 - 1 of 1 FAQs).

1. I am looking for a good antibody to detect Bassoon in mouse brain slices (PFA fixed); can you recommend any one for this?
   • After searching through our product catalog list, we have found the following antibodies which may be of interest: Bassoo. Using the filters on the left column of the site should allow you to filter by species and desired application. Any antibody that is listed to show validation for use in IHC-P and has also been validated in mouse samples will be backed by our 100% Guarantee. Under the terms and conditions of the guarantee, Novus will provide you with a full refund or replacement should the antibody fail to perform, as specified, in samples expressing the protein.

Bioinformatics

• Gene Symbol: BSN
• Entrez:
  • 8927(Human)
• Uniprot:
  • Q9UPA5(Human)