BARHL1 Antibody

Images

 
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human cerebellum shows moderate nuclear positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human skeletal muscle shows weak positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BARHL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
Specificity
Specificity of human BARHL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BARHL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
BARHL1 Protein (NBP1-86513PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BARHL1 Antibody

  • BarH (Drosophila)-like 1
  • barH-like 1 homeobox protein
  • BarH-like homeobox 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005459-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-31318
Species: Mu
Applications: IHC-P
H00343472-Q01
Species: Hu
NBP1-31318
Species: Mu
Applications: IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NLS2656
Species: Hu
Applications: WB, IHC, IHC-P, ICC
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
H00004826-P01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-86513
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for BARHL1 Antibody (NBP1-86513) (0)

There are no publications for BARHL1 Antibody (NBP1-86513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BARHL1 Antibody (NBP1-86513) (0)

There are no reviews for BARHL1 Antibody (NBP1-86513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BARHL1 Antibody (NBP1-86513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BARHL1 Antibody (NBP1-86513)

Discover related pathways, diseases and genes to BARHL1 Antibody (NBP1-86513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARHL1 Antibody (NBP1-86513)

Discover more about diseases related to BARHL1 Antibody (NBP1-86513).
 

Pathways for BARHL1 Antibody (NBP1-86513)

View related products by pathway.

PTMs for BARHL1 Antibody (NBP1-86513)

Learn more about PTMs related to BARHL1 Antibody (NBP1-86513).

Blogs on BARHL1

There are no specific blogs for BARHL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BARHL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BARHL1