BARHL1 Antibody

Images

 
Western Blot: BARHL1 Antibody [NBP1-86513] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of mouse embryo E14 shows strong nuclear positivity in neuronal cells in developing brain stem and cerebellum.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human cerebellum shows weak nuclear positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BARHL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
Specificity
Specificity of human BARHL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BARHL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID:31641054).
Control Peptide
BARHL1 Protein (NBP1-86513PEP)
Publications
Read Publications using
NBP1-86513 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • PA
    1 publication

Reactivity Notes

Rat and Mouse reactivity reported in scientific literature (PMID: 31641054). Mouse reactivity reported in scientific literature (PMID: 28094018). Rat reactivity reported in scientific literature (PMID: 30007046).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BARHL1 Antibody

  • BarH (Drosophila)-like 1
  • barH-like 1 homeobox protein
  • BarH-like homeobox 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005459-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-45693
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-45693
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm, All-NA
Applications: WB, IHC, IHC-P
NB120-3481
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm
Applications: WB, IHC
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00000894-B01P
Species: Hu, Rt
Applications: WB
NBP2-61710
Species: Hu, Rt
Applications: WB, ELISA, Flow
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-57015
Species: Hu
Applications: WB
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-86513
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BARHL1 Antibody (NBP1-86513)(6)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, PA.


Filter By Application
ICC/IF
(1)
IHC
(1)
PA
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
Rat
(3)
All Species

Reviews for BARHL1 Antibody (NBP1-86513) (0)

There are no reviews for BARHL1 Antibody (NBP1-86513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BARHL1 Antibody (NBP1-86513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BARHL1 Products

Bioinformatics Tool for BARHL1 Antibody (NBP1-86513)

Discover related pathways, diseases and genes to BARHL1 Antibody (NBP1-86513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARHL1 Antibody (NBP1-86513)

Discover more about diseases related to BARHL1 Antibody (NBP1-86513).
 

Pathways for BARHL1 Antibody (NBP1-86513)

View related products by pathway.

PTMs for BARHL1 Antibody (NBP1-86513)

Learn more about PTMs related to BARHL1 Antibody (NBP1-86513).

Blogs on BARHL1

There are no specific blogs for BARHL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BARHL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BARHL1