BARHL1 Antibody

Western Blot: BARHL1 Antibody [NBP1-86513] - Analysis in human cell line SCLC-21H.

Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of mouse embryo E14 shows strong nuclear positivity in neuronal cells in developing brain stem and cerebellum.

Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human cerebellum shows weak nuclear positivity in cells in molecular layer.

Immunohistochemistry-Paraffin: BARHL1 Antibody [NBP1-86513] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BARHL1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
• Specificity: Specificity of human BARHL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BARHL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Rat and Mouse reactivity reported in scientific literature (PMID: 31641054). Mouse reactivity reported in scientific literature (PMID: 28094018). Rat reactivity reported in scientific literature (PMID: 30007046).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BARHL1 Antibody

• BarH (Drosophila)-like 1
• barH-like 1 homeobox protein
• BarH-like homeobox 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BARHL1 Antibody (NBP1-86513)(4)

Publications using NBP1-86513

• Cardoso T Cell Replacement Therapy for Parkinson’s Disease: Potential for Circuitry Repair Dissertation 2018 Nov 30 (PA, Human)
• de Luzy IR, Niclis JC, Gantner CW et al. Isolation of LMX1a ventral midbrain progenitors improves the safety and predictability of human pluripotent stem cell-derived neural transplants in Parkinsonian Disease J. Neurosci. 2019 Oct 21 [PMID: 31641054] (ICC/IF, Rat, Mouse)
• Cardoso T, Adler AF, Mattsson B et al. Target-specific forebrain projections and appropriate synaptic inputs of hESC-derived dopamine neurons grafted to the midbrain of parkinsonian rats J Comp Neurol. 2018 Sep 1 [PMID: 30007046] (Rat)
• Kee N, Volakakis N, Kirkeby A et al. Single-Cell Analysis Reveals a Close Relationship between Differentiating Dopamine and Subthalamic Nucleus Neuronal Lineages Cell Stem Cell 2017 Jan 5 [PMID: 28094018] (IHC, Mouse)

Bioinformatics

• Gene Symbol: BARHL1