BANF1 Antibody (6J8O2)

Western Blot: BANF1 Antibody (6J8O2) [NBP3-16263] - Western blot analysis of extracts of various cell lines, using BANF1 Rabbit mAb (NBP3-16263) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry: BANF1 Antibody (6J8O2) [NBP3-16263] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using BANF1 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: BANF1 Antibody (6J8O2) [NBP3-16263] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using BANF1 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: BANF1 Antibody (6J8O2) [NBP3-16263] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using BANF1 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: BANF1 Antibody (6J8O2) [NBP3-16263] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using BANF1 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: BANF1 Antibody (6J8O2) [NBP3-16263] - Immunofluorescence analysis of HeLa cells using BANF1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 6J8O2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

BANF1 Antibody (6J8O2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (O75531). MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BANF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BANF1 Antibody (6J8O2)

• BAFMGC111161
• BANF1
• barrier to autointegration factor 1
• barrier-to-autointegration factor
• BCRG1
• BCRP1
• Breakpoint cluster region protein 1
• D14S1460

Background

BANF1 is encoded by this gene was identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The endogenous function of the protein is unknown. The protein forms a homodimer which localizes to the nucleus and is specifically associated with chromosomes during mitosis. This protein binds to DNA in a non-specific manner and studies in rodents suggest that it also binds to lamina-associated polypeptide 2, a component of the nuclear lamina.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BANF1