BACE-1 Antibody


Western Blot: BACE-1 Antibody [NBP1-62416] - Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.
Immunocytochemistry/ Immunofluorescence: BACE-1 Antibody [NBP1-62416] - Mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).
Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human testis tissue at an antibody concentration of 4-8ug/ml.
Western Blot: BACE-1 Antibody [NBP1-62416] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: more
Western Blot: BACE-1 Antibody [NBP1-62416] - Astrocytes, Antibody Titration: 0.2-1 ug/ml
Western Blot: BACE-1 Antibody [NBP1-62416] - Mouse WT brain and Rat brain, concentration 2ug/ml.
Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

BACE-1 Antibody Summary

Synthetic peptides corresponding to BACE1/beta-secretase 1 (beta-site APP-cleaving enzyme 1) The peptide sequence was selected from the N terminal of BACE1/beta-secretase 1 (NP_036236). Peptide sequence GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-2 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BACE-1 Antibody

  • APP beta-secretase
  • ASP2
  • Aspartyl protease 2
  • BACE1
  • BACE-1
  • BACEAsp 2
  • beta-secretase 1 precursor variant 1
  • beta-secretase 1
  • beta-site amyloid beta A4 precursor protein-cleaving enzyme
  • Beta-site amyloid precursor protein cleaving enzyme 1
  • Beta-site APP cleaving enzyme 1
  • beta-site APP-cleaving enzyme 1
  • beta-site APP-cleaving enzyme
  • EC 3.4.23
  • EC
  • FLJ90568
  • HSPC104
  • KIAA1149
  • memapsin-2
  • Membrane-associated aspartic protease 2
  • transmembrane aspartic proteinase Asp2


Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu, Rt, Bv, Ca, Eq, Op
Applications: WB
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for BACE-1 Antibody (NBP1-62416) (0)

There are no publications for BACE-1 Antibody (NBP1-62416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BACE-1 Antibody (NBP1-62416) (0)

There are no reviews for BACE-1 Antibody (NBP1-62416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BACE-1 Antibody (NBP1-62416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for BACE-1 Antibody (NBP1-62416)

Discover related pathways, diseases and genes to BACE-1 Antibody (NBP1-62416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BACE-1 Antibody (NBP1-62416)

Discover more about diseases related to BACE-1 Antibody (NBP1-62416).

Pathways for BACE-1 Antibody (NBP1-62416)

View related products by pathway.

PTMs for BACE-1 Antibody (NBP1-62416)

Learn more about PTMs related to BACE-1 Antibody (NBP1-62416).

Blogs on BACE-1

There are no specific blogs for BACE-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BACE-1 Antibody and receive a gift card or discount.


Gene Symbol BACE1