B4GALT6 Antibody

Images

 
Western Blot: B4GALT6 Antibody [NBP1-69019] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Liver.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B4GALT6 Antibody Summary

Immunogen
Synthetic peptides corresponding to B4galt6 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6) The peptide sequence was selected from the C terminal of B4galt6 (NP_062711). Peptide sequence GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B4GALT6 Antibody

  • B4Gal-T6
  • beta-1,4-galactosyltransferase 6
  • Beta-1,4-GalTase 6
  • beta4Gal-T6
  • beta4GalT-VI
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6
  • UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6

Background

B4galt6 is required for the biosynthesis of glycosphingolipids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
AF1267
Species: Hu
Applications: WB, IP, Neut
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-611
Species: Hu
Applications: WB, IP
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for B4GALT6 Antibody (NBP1-69019) (0)

There are no publications for B4GALT6 Antibody (NBP1-69019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT6 Antibody (NBP1-69019) (0)

There are no reviews for B4GALT6 Antibody (NBP1-69019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALT6 Antibody (NBP1-69019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B4GALT6 Products

Bioinformatics Tool for B4GALT6 Antibody (NBP1-69019)

Discover related pathways, diseases and genes to B4GALT6 Antibody (NBP1-69019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALT6 Antibody (NBP1-69019)

Discover more about diseases related to B4GALT6 Antibody (NBP1-69019).
 

Pathways for B4GALT6 Antibody (NBP1-69019)

View related products by pathway.

PTMs for B4GALT6 Antibody (NBP1-69019)

Learn more about PTMs related to B4GALT6 Antibody (NBP1-69019).

Blogs on B4GALT6

There are no specific blogs for B4GALT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B4GALT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT6
Entrez
Uniprot