B4GALNT1 Antibody

Images

 
Western Blot: B4GALNT1 Antibody [H00002583-D01P] - Analysis of B4GALNT1 expression in transfected 293T cell line by B4GALNT1 polyclonal antibody.Lane 1: B4GALNT1 transfected lysate(35.50 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B4GALNT1 Antibody Summary

Immunogen
B4GALNT1 (AAH29828.1, 1 a.a. - 328 a.a.) full-length human protein. MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV
Specificity
B4GALNT1 - beta-1,4-N-acetyl-galactosaminyl transferase 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALNT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B4GALNT1 Antibody

  • (N-acetylneuraminyl)-galactosylglucosylceramide
  • beta-1,4 N-acetylgalactosaminyltransferase 1
  • beta1,4GalNAc-T
  • beta-1,4-N-acetyl-galactosaminyl transferase 1
  • beta1-4GalNAc-T
  • GALGTEC 2.4.1.92
  • GALNACT
  • GalNAc-T
  • GD2 synthase, GM2 synthase
  • GM2/GD2 synthase
  • SIAT2
  • UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T)

Background

GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-15533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBL1-16214
Species: Hu
H00002583-D01P
Species: Hu
Applications: WB

Publications for B4GALNT1 Antibody (H00002583-D01P) (0)

There are no publications for B4GALNT1 Antibody (H00002583-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALNT1 Antibody (H00002583-D01P) (0)

There are no reviews for B4GALNT1 Antibody (H00002583-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALNT1 Antibody (H00002583-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B4GALNT1 Products

Bioinformatics Tool for B4GALNT1 Antibody (H00002583-D01P)

Discover related pathways, diseases and genes to B4GALNT1 Antibody (H00002583-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALNT1 Antibody (H00002583-D01P)

Discover more about diseases related to B4GALNT1 Antibody (H00002583-D01P).
 

Pathways for B4GALNT1 Antibody (H00002583-D01P)

View related products by pathway.

Blogs on B4GALNT1

There are no specific blogs for B4GALNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B4GALNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALNT1
Entrez
Uniprot