B3GALT5 Antibody

Images

 
Immunohistochemistry: B3GALT5 Antibody [NBP2-30879] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GALT5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GALT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B3GALT5 Protein (NBP2-30879PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GALT5 Antibody

  • b3Gal-T5
  • B3GalTx
  • Beta-1,3-GalTase 5
  • Beta3GalT5
  • Beta3Gal-T5
  • EC 2.4.1
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5,10Beta-3-Gx-T5
  • UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5
  • UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-69327
Species: Hu
Applications: WB
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
4949-GT
Species: Hu
NBP1-57016
Species: Hu
Applications: WB

Publications for B3GALT5 Antibody (NBP2-30879) (0)

There are no publications for B3GALT5 Antibody (NBP2-30879).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALT5 Antibody (NBP2-30879) (0)

There are no reviews for B3GALT5 Antibody (NBP2-30879). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B3GALT5 Antibody (NBP2-30879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALT5 Products

Bioinformatics Tool for B3GALT5 Antibody (NBP2-30879)

Discover related pathways, diseases and genes to B3GALT5 Antibody (NBP2-30879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GALT5 Antibody (NBP2-30879)

Discover more about diseases related to B3GALT5 Antibody (NBP2-30879).
 

Pathways for B3GALT5 Antibody (NBP2-30879)

View related products by pathway.

PTMs for B3GALT5 Antibody (NBP2-30879)

Learn more about PTMs related to B3GALT5 Antibody (NBP2-30879).

Blogs on B3GALT5

There are no specific blogs for B3GALT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALT5
Uniprot