Recombinant Human B-Myb Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human B-Myb Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 601 - 700 of Human MYBL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYBL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human B-Myb Protein

  • B-MYB
  • BMYBMGC15600
  • Myb-like protein 2
  • myb-related protein B
  • v-myb avian myeloblastosis viral oncogene homolog-like 2
  • v-myb myeloblastosis viral oncogene homolog (avian)-like 2

Background

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90171
Species: Hu
Applications: IHC, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for B-Myb Partial Recombinant Protein (H00004605-Q01) (0)

There are no publications for B-Myb Partial Recombinant Protein (H00004605-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B-Myb Partial Recombinant Protein (H00004605-Q01) (0)

There are no reviews for B-Myb Partial Recombinant Protein (H00004605-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B-Myb Partial Recombinant Protein (H00004605-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B-Myb Products

Bioinformatics Tool for B-Myb Partial Recombinant Protein (H00004605-Q01)

Discover related pathways, diseases and genes to B-Myb Partial Recombinant Protein (H00004605-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B-Myb Partial Recombinant Protein (H00004605-Q01)

Discover more about diseases related to B-Myb Partial Recombinant Protein (H00004605-Q01).
 

Pathways for B-Myb Partial Recombinant Protein (H00004605-Q01)

View related products by pathway.

PTMs for B-Myb Partial Recombinant Protein (H00004605-Q01)

Learn more about PTMs related to B-Myb Partial Recombinant Protein (H00004605-Q01).
 

Research Areas for B-Myb Partial Recombinant Protein (H00004605-Q01)

Find related products by research area.

Blogs on B-Myb

There are no specific blogs for B-Myb, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
B-Myb Antibody
NBP2-33930

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human B-Myb Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYBL2