B-Myb Antibody

Immunohistochemistry-Paraffin: B-Myb Antibody [NBP2-33930] - Staining of human Stomach shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: B-Myb Antibody [NBP2-33930] - Staining of human skin shows strong nuclear positivity in fibroblasts.

Immunohistochemistry-Paraffin: B-Myb Antibody [NBP2-33930] - Staining of human spleen shows strong nuclear positivity in a subset of lymphoid cells.

Immunohistochemistry-Paraffin: B-Myb Antibody [NBP2-33930] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: B-Myb Antibody [NBP2-33930] - Staining of human tonsil shows moderate nuclear positivity in a subset of lymphoid cells.

Product Discontinued

B-Myb Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSL
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYBL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for B-Myb Antibody

• B-MYB
• BMYBMGC15600
• Myb-like protein 2
• myb-related protein B
• v-myb avian myeloblastosis viral oncogene homolog-like 2
• v-myb myeloblastosis viral oncogene homolog (avian)-like 2

Background

B MyB is encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYBL2
• Uniprot:
  • P10244(Human)