B-Myb Antibody (5G5)

Images

 
Western Blot: B-Myb Antibody (5G5) [H00004605-M03] - Analysis of MYBL2 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: B-Myb Antibody (5G5) [H00004605-M03] - Analysis of monoclonal antibody to MYBL2 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: B-Myb Antibody (5G5) [H00004605-M03] - Detection limit for recombinant GST tagged MYBL2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

B-Myb Antibody (5G5) Summary

Immunogen
MYBL2 (AAH53555 601 a.a. - 700 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
Specificity
MYBL2 (5G5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYBL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B-Myb Antibody (5G5)

  • B-MYB
  • BMYBMGC15600
  • Myb-like protein 2
  • myb-related protein B
  • v-myb avian myeloblastosis viral oncogene homolog-like 2
  • v-myb myeloblastosis viral oncogene homolog (avian)-like 2

Background

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90171
Species: Hu
Applications: IHC, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for B-Myb Antibody (H00004605-M03) (0)

There are no publications for B-Myb Antibody (H00004605-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B-Myb Antibody (H00004605-M03) (0)

There are no reviews for B-Myb Antibody (H00004605-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for B-Myb Antibody (H00004605-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B-Myb Products

Bioinformatics Tool for B-Myb Antibody (H00004605-M03)

Discover related pathways, diseases and genes to B-Myb Antibody (H00004605-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B-Myb Antibody (H00004605-M03)

Discover more about diseases related to B-Myb Antibody (H00004605-M03).
 

Pathways for B-Myb Antibody (H00004605-M03)

View related products by pathway.

PTMs for B-Myb Antibody (H00004605-M03)

Learn more about PTMs related to B-Myb Antibody (H00004605-M03).
 

Research Areas for B-Myb Antibody (H00004605-M03)

Find related products by research area.

Blogs on B-Myb

There are no specific blogs for B-Myb, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B-Myb Antibody (5G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYBL2
Entrez
OMIM
Uniprot