Axotrophin Antibody - BSA Free

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90056] - Staining of human cerebral cortex, colon, liver and lymph node using Anti-MARCH7 antibody NBP1-90056 (A) shows similar protein distribution across tissues to independent antibody NBP1-90057 (B).

Western Blot: Axotrophin Antibody [NBP1-90056] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: Axotrophin Antibody [NBP1-90056] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90056] - Staining of human liver.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90056] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90056] - Staining of human lymph node.

Immunohistochemistry-Paraffin: Axotrophin Antibody [NBP1-90056] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Axotrophin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Axotrophin Antibody - BSA Free (NBP1-90056) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Axotrophin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSRSNTQPGFSYSSSRDEAPIISNSERVVSSQRPFQESSDNEGRRTTRRLLSRIASSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVPDNRASEASQGFRFLRRRWGLSSLSHNHSSESDSENFNQESE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCH7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Axotrophin Protein (NBP1-90056PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Axotrophin Antibody - BSA Free

• AXO
• AXOT
• Axotrophin
• E3 ubiquitin-protein ligase MARCH7
• EC 6.3.2
• EC 6.3.2.-
• MARCH-VIIDKFZp586F1122
• membrane-associated ring finger (C3HC4) 7
• Membrane-associated RING finger protein 7
• Membrane-associated RING-CH protein VII
• RING finger protein 177
• RNF177axotrophin

Background

E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligasesaccept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer theubiquitin to targeted substrates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Axotrophin Antibody (NBP1-90056)(1)

Publication using NBP1-90056

• Liu, L;Hu, J;Yu, T;You, S;Zhang, Y;Hu, L; miR-27b-3p/MARCH7 regulates invasion and metastasis of endometrial cancer cells through Snail-mediated pathway Acta Biochim. Biophys. Sin. (Shanghai) 2019-04-22 [PMID: 31006800] (WB, Human)

Bioinformatics

• Gene Symbol: MARCH7