Aurora A Recombinant Protein Antigen

Images

 
There are currently no images for Aurora A Protein (NBP1-90103PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aurora A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AURKA.

Source: E. coli

Amino Acid Sequence: ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AURKA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90103.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aurora A Recombinant Protein Antigen

  • AIK
  • AIKAurA
  • ARK1
  • ARK-1
  • ARK1EC 2.7.11.1
  • AURA
  • AURKA
  • Aurora A
  • aurora kinase AhARK1
  • aurora/IPL1-like kinase
  • Aurora/IPL1-related kinase 1
  • Aurora-related kinase 1
  • Breast tumor-amplified kinase
  • breast-tumor-amplified kinase
  • BTAK
  • BTAKAURORA2
  • EC 2.7.11
  • IPL1-related kinase
  • serine/threonine kinase 6
  • serine/threonine protein kinase 15
  • Serine/threonine-protein kinase 15
  • serine/threonine-protein kinase 6
  • Serine/threonine-protein kinase aurora-A
  • STK15
  • STK15serine/threonine kinase 15
  • STK6
  • STK6MGC34538
  • STK7

Background

The protein encoded by the Aurora A gene is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. The encoded protein is found at the centrosome in interphase cells and at the spindle poles in mitosis. This gene may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-32061
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1308
Species: Mu
Applications: Block, CyTOF-ready, Flow, IF, IHC, WB
AF3847
Species: Hu
Applications: ICC, WB
NB500-179
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
NBP3-17040
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB100-74502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
H00051380-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF2935
Species: Hu
Applications: WB
NBP1-84954
Species: Hu
Applications: IHC,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Aurora A Protein (NBP1-90103PEP) (0)

There are no publications for Aurora A Protein (NBP1-90103PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora A Protein (NBP1-90103PEP) (0)

There are no reviews for Aurora A Protein (NBP1-90103PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aurora A Protein (NBP1-90103PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aurora A Products

Research Areas for Aurora A Protein (NBP1-90103PEP)

Find related products by research area.

Blogs on Aurora A

There are no specific blogs for Aurora A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aurora A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKA