Aurora A Recombinant Protein Antigen

Images

 
There are currently no images for Aurora A Protein (NBP1-90103PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aurora A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AURKA.

Source: E.coli

Amino Acid Sequence: ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AURKA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90103.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Aurora A Recombinant Protein Antigen

  • AIK
  • AIKAurA
  • ARK1
  • ARK-1
  • ARK1EC 2.7.11.1
  • AURA
  • AURKA
  • Aurora A
  • aurora kinase AhARK1
  • aurora/IPL1-like kinase
  • Aurora/IPL1-related kinase 1
  • Aurora-related kinase 1
  • Breast tumor-amplified kinase
  • breast-tumor-amplified kinase
  • BTAK
  • BTAKAURORA2
  • EC 2.7.11
  • IPL1-related kinase
  • serine/threonine kinase 6
  • serine/threonine protein kinase 15
  • Serine/threonine-protein kinase 15
  • serine/threonine-protein kinase 6
  • Serine/threonine-protein kinase aurora-A
  • STK15
  • STK15serine/threonine kinase 15
  • STK6
  • STK6MGC34538
  • STK7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00004854-M01
Species: Hu
Applications: WB, ELISA
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-90103PEP
Species: Hu
Applications: AC

Publications for Aurora A Protein (NBP1-90103PEP) (0)

There are no publications for Aurora A Protein (NBP1-90103PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora A Protein (NBP1-90103PEP) (0)

There are no reviews for Aurora A Protein (NBP1-90103PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Aurora A Protein (NBP1-90103PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aurora A Products

Bioinformatics Tool for Aurora A Protein (NBP1-90103PEP)

Discover related pathways, diseases and genes to Aurora A Protein (NBP1-90103PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aurora A Protein (NBP1-90103PEP)

Discover more about diseases related to Aurora A Protein (NBP1-90103PEP).
 

Pathways for Aurora A Protein (NBP1-90103PEP)

View related products by pathway.

PTMs for Aurora A Protein (NBP1-90103PEP)

Learn more about PTMs related to Aurora A Protein (NBP1-90103PEP).
 

Research Areas for Aurora A Protein (NBP1-90103PEP)

Find related products by research area.

Blogs on Aurora A

There are no specific blogs for Aurora A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aurora A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKA
Entrez